id: 2VM6_A55_A135

Field Value
Uniprot ID Q16548
Experiment ID 2VM6
Source DB PDB
Motif 3-helix bundle
Motif ID 2VM6_A55_A135
Chain A
Start 55
End 135
Length 81
Protein partners BCL2L11 (O43521)
FASTA
CLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIR
Show All
Rg, Å 13.435859
Resolution 2.2
Experiment type X-ray
SASA, Ų 5770.9844
Protein name Bcl-2-related protein A1
Surface K 0.7344118
Experiment name Human Bcl2-A1 in complex with Bim-BH3 peptide
Inner HB 24
Organism Homo sapiens
Inner HP 95
Inner disulph 0
Taxon ID 9606
Outer HB 11
Weight, Da 20101.154
Outer disulph 0
Motif weight, Da 9406.834
Motif % in protein 46.79748
Binding sites No
α-helices 3
β-strands 0
Coils 4
α-helical length 51
β-strand length 0
Coil length 30

CATH: 1.20.5

The motif is characterized by a unique, compact spatial arrangement consisting of three consecutive helices connected by irregular loop regions. The connecting loops vary in length from 2 to 28 amino acids. Typically, three-helix bundle structures are approximately 80 amino acids in length. This motif features a pronounced hydrophobic core, with both hydrogen bonds and hydrophobic interactions stabilizing its three-dimensional structure.

The three-helix bundle is a common fold found in small proteins as well as in domains of larger homologous and non-homologous proteins. It is present in diverse protein classes, including DNA-binding proteins, enzymes, lysine-rich proteins, and enzyme inhibitors. Furthermore, the three-helical bundle often functions as a structural subdomain within the tertiary structure of many large proteins.